Gene Rv0109
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family protein PE_PGRS1 |
| Comments | Rv0109, (MTV031.03c), len: 496 aa. PE_PGRS1, Member of the M. tuberculosis PE family, PGRS subfamily of gly-rich proteins (see Brennan and Delogu, 2002), highly similar to many e.g. Q50615|Y0DP_MYCTU hypothetical glycine-rich 40.8 kDa protein from Mycobacterium tuberculosis (498 aa), FASTA scores: opt: 1772, E(): 0, (57.3% identity in 513 aa overlap); etc. |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 131382 | 132872 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0109|PE_PGRS1
MSLLITSPATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGADEVSVLIAALFEAYAQEYQALSAQALAFHDQFVQALNMGAVCYAAAETANATPLQALQTVQQNVLTVVNAPTQALLGRPIIGNGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGNGGAAGLIGNGGSGGVGGPGIAGSAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGGNAIGLFGSGGTGGMGGVGGMGGVGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGGGGNGRFMGNGGVGGAGGYGASGDGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGGNAGFVRNGGAGGNGQLGSGAVSSAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNAVGLFGQGGAGGAGGSGFGAGIPGGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGNARLIGNGGDGGPGMFGGPGGAGGSGGTIFGFAGTPGPS
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant