Gene Rv0145
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possible methyltransferase |
| Product | Possible S-adenosylmethionine-dependent methyltransferase |
| Comments | Rv0145, (MTCI5.19), len: 317 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), highly similar to many e.g. CAC32172.1|AL583926 conserved hypothetical protein from Mycobacterium leprae (310 aa); and several Mycobacterium tuberculosis proteins e.g. Rv0726c, Rv0731c, etc. |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 171215 | 172168 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0145|Rv0145
VTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAATNPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYFGAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTARRHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQVAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSNREEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Bai G, Gazdik MA, Schaak DD and McDonough KA [2007]. The Mycobacterium bovis BCG cyclic AMP receptor-like protein is a functional DNA binding protein in vitro and in vivo, but its activity differs from that of its M. tuberculosis ortholog, Rv3676. Regulon
- Graña M et al. [2007]. The crystal structure of M. leprae ML2640c defines a large family of putative S-adenosylmethionine-dependent methyltransferases in mycobacteria. Function
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
