Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossible methyltransferase
ProductPossible S-adenosylmethionine-dependent methyltransferase
CommentsRv0145, (MTCI5.19), len: 317 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), highly similar to many e.g. CAC32172.1|AL583926 conserved hypothetical protein from Mycobacterium leprae (310 aa); and several Mycobacterium tuberculosis proteins e.g. Rv0726c, Rv0731c, etc.
Functional categoryLipid metabolism
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS171215172168+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0145|Rv0145
VTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAATNPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYFGAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTARRHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQVAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSNREEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA