Gene Rv0150c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv0150c, (MTCI5.24c), len: 95 aa. Conserved hypothetical protein, showing some similarity with C-terminus of O53949|Rv1800|MTV049.22 PPE-family protein from Mycobacterium tuberculosis (655 aa), FASTA score: (36.5% identity in 104 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 176665 | 176952 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0150c|Rv0150c MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTADIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant