Gene Rv0174
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but thought involved in host cell invasion. |
| Product | Mce-family protein Mce1F |
| Comments | Rv0174, (MTCI28.14), len: 515 aa. Mce1F; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), similar to Mycobacterium tuberculosis proteins O07784|Rv0594|MTCY19H5.28c|mce2F (516 aa); O53972|Rv1971|MTV051.09|mce3F (437 aa); etc. Also highly similar to others e.g. NP_302661.1|NC_002677 putative secreted protein from Mycobacterium leprae (516 aa); AAF74993.1|AF143400_1|AF143400|996A027a protein from Mycobacterium avium (80 aa) (similarity on C-terminus); CAC12793.1|AL445327 putative secreted protein from Streptomyces coelicolor (433 aa); etc. Has hydrophobic stretch, possibly a signal peptide at the N-terminus. Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | - |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by RT-PCR (see Harboe et al., 1999). mRNA also identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). RT-qPCR shows higher expression of fadD5|Rv0166, mce1A|Rv0169 and mce1F|Rv0174 in M. tuberculosis H37Rv mce1R|Rv0165 mutant than in H37Rv, after infection of murine macrophages (See Casali et al., 2006). |
| Operon | Rv0173 and Rv0174, Rv0174 and Rv0175 are co-transcribed, by RT-PCR (See Casali et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 205231 | 206778 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0174|mce1F
VLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETAQAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRGARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPNQILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS
Bibliography
- Arruda S, Bomfim G, Knights R, Huima-Byron T and Riley LW [1993]. Cloning of an M. tuberculosis DNA fragment associated with entry and survival inside cells. Sequence
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Harboe M, Christensen A, Haile Y, Ulvund G, Ahmad S, Mustafa AS and Wiker HG [1999]. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Product Transcriptome
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Panigada M et al. [2002]. Identification of a promiscuous T-cell epitope in Mycobacterium tuberculosis Mce proteins. Gene
- Haile Y et al. [2002]. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Homolog Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Casali N, White AM and Riley LW [2006]. Regulation of the Mycobacterium tuberculosis mce1 operon. Mutant Operon
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant