Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, but thought involved in host cell invasion.
ProductMce-family protein Mce1F
CommentsRv0174, (MTCI28.14), len: 515 aa. Mce1F; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), similar to Mycobacterium tuberculosis proteins O07784|Rv0594|MTCY19H5.28c|mce2F (516 aa); O53972|Rv1971|MTV051.09|mce3F (437 aa); etc. Also highly similar to others e.g. NP_302661.1|NC_002677 putative secreted protein from Mycobacterium leprae (516 aa); AAF74993.1|AF143400_1|AF143400|996A027a protein from Mycobacterium avium (80 aa) (similarity on C-terminus); CAC12793.1|AL445327 putative secreted protein from Streptomyces coelicolor (433 aa); etc. Has hydrophobic stretch, possibly a signal peptide at the N-terminus. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional category-
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsmRNA identified by RT-PCR (see Harboe et al., 1999). mRNA also identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). RT-qPCR shows higher expression of fadD5|Rv0166, mce1A|Rv0169 and mce1F|Rv0174 in M. tuberculosis H37Rv mce1R|Rv0165 mutant than in H37Rv, after infection of murine macrophages (See Casali et al., 2006).
OperonRv0173 and Rv0174, Rv0174 and Rv0175 are co-transcribed, by RT-PCR (See Casali et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS205231206778+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0174|mce1F
VLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETAQAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRGARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPNQILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS
      
Bibliography