Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in transfer of methyl group.
ProductProbable O-methyltransferase
CommentsRv0187, (MTCI28.26), len: 220 aa. Probable O-methyltransferase, similar to many e.g. AB93458.1|AL357591 putative O-methyltransferase from Streptomyces coelicolor (223 aa); MDMC_STRMY|Q00719 O-methyltransferase from Streptomyces mycarofaciens (221 aa), FASTA scores: opt: 327, E(): 2.4e-17, (35.9% identity in 192 aa overlap). Also similar to Rv1703c, Rv1220c from Mycobacterium tuberculosis.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS218705219367+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0187|218705-219367|+|Rv0187|downstream:0|upstream:0
ttgggcatggaccagcaacccaacccgcccgacgtcgacgcatttttggacagcacactggtcggcgacgatccggcgttagccgcggcattggcggccagcgacgcggccgagttaccccgcatcgcggtgtcggcacagcagggcaagttcctgtgcctgctggccggtgccatccaggcgcgccgcgtcctcgagatcggcacactcggtggcttcagcaccatttggctggcgcgtggcgcgggcccacagggacgggtggtcacgctggaataccagcccaagcacgctgaggtcgcccgggtgaacctgcagcgagcgggcgtcgccgatcgggtggaggtggtcgtcggtccggcgctggacacgttgccgacgttggccggtggcccgttcgacctggtgttcatcgacgccgacaaagagaacaacgtcgcatatattcagtgggcgatccggttggcccggcgcggcgcagtgatcgtggtggacaacgttattcgtggcggcgggattcttgctgagtccgacgatgccgacgcagtggcggcacgtcggacgctgcaaatgatgggtgagcaccccggcctagacgccacggcgatccagaccgtcgggcgcaagggctgggacggtttcgccctcgctttggtgcggtag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0187|Rv0187
LGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR