Gene Rv0224c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Causes methylation |
| Product | Possible methyltransferase (methylase) |
| Comments | Rv0224c, (MTCY08D5.19c), len: 254 aa. Possible methyltransferase, showing weak similarity with other methyltransferases e.g. P74388 sterol-C-methyltransferase (318 aa), FASTA scores: opt: 190, E(): 3.6e-05, (33.3% identity in 114 aa overlap). Equivalent to AL022486|MLCB1883_1 from Mycobacterium leprae (269 aa), FASTA scores: opt: 1456, E(): 0, (82.9% identity in 252 aa overlap). Also some similarity with MTCY21B4.22c from Mycobacterium tuberculosis FASTA score: (30.1% identity in 136 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Essential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 267863 | 268627 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0224c|Rv0224c
VAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMIGDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRPGMFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLGPFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAVFPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
