Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCauses methylation
ProductPossible methyltransferase (methylase)
CommentsRv0224c, (MTCY08D5.19c), len: 254 aa. Possible methyltransferase, showing weak similarity with other methyltransferases e.g. P74388 sterol-C-methyltransferase (318 aa), FASTA scores: opt: 190, E(): 3.6e-05, (33.3% identity in 114 aa overlap). Equivalent to AL022486|MLCB1883_1 from Mycobacterium leprae (269 aa), FASTA scores: opt: 1456, E(): 0, (82.9% identity in 252 aa overlap). Also some similarity with MTCY21B4.22c from Mycobacterium tuberculosis FASTA score: (30.1% identity in 136 aa overlap).
Functional categoryIntermediary metabolism and respiration
MutantEssential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS267863268627-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0224c|Rv0224c
VAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMIGDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRPGMFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLGPFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAVFPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP