Gene Rv0259c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0259c, (MTCY06A4.03c), len: 247 aa. Conserved hypothetical protein, showing some similarity to Rv2393|Z81368|MTCY253_28 from Mycobacterium tuberculosis (281 aa), FASTA scores: E(): 9.5e-16, (33.6 % identity in 235 aa overlap). Also some similarity with CAC33938.1|AL589708 putative secreted protein from Streptomyces coelicolor (248 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 310774 | 311517 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0259c|Rv0259c
MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPSPSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVTQQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRTAVQRARDRAEANRGARRVAVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANRFRSAVARQQRLHRWHGTPTPVTLDL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
