Gene Rv0264c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0264c, (MTCY06A4.08c), len: 210 aa. Conserved hypothetical protein, equivalent to CAC32080.1|AL583926 conserved hypothetical protein from Mycobacterium leprae (222 aa). Also similar to others hypothetical proteins e.g. AL121596|SC51A_20 from Streptomyces coelicolor (252 aa), FASTA scores: opt: 420, E(): 2.7e-20, (41.7% identity in 204 aa overlap); P75744|YBGJ_ECOLI hypothetical 23.9 KD protein from Escherichia coli (218 aa), FASTA scores: E(): 2.1e-14, (35.7% identity in 182 aa overlap); YH31_HAEIN|P44299|hi173 hypothetical protein from Haemophilus influenzae (213 aa), FASTA scores: opt: 252, E(): 8.3e-10, (31.1% identity in 183 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 315783 | 316415 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0264c|Rv0264c
MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDIVAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLAEVARCTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMPPGSVALADGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
