Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly hydrolyzes specific sugar (hydrolyzation of glycosidic bond) and could be involved in exopolysaccharide biosynthesis/degradation. Could also have a LYTIC activity against cell WALLS.
ProductPossible beta-1,3-glucanase precursor
CommentsRv0315, (MTCY63.20), len: 294 aa. Possible beta-1,3-glucanase precursor (has hydrophobic stretch in its N-terminal part), similar to others e.g. Q51333|AAC44371.1 beta-1,3-glucanase II a from Oerskovia xanthineolytica (306 aa), FASTA scores: opt: 76, E(): 3e-14, (34.1% identity in 302 aa overlap); and AAC38290.1|AF052745 beta-1,3-glucanase II from Oerskovia xanthineolytica (435 aa). Contains glycosyl hydrolases family 16 active site signature (PS01034).
Functional categoryIntermediary metabolism and respiration
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS383602384486+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0315|Rv0315
MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPAPAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQNVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMYFWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYKVFPVLNLAVGGSGGGDPATGSYPQEMLVDWVRVF