Gene Rv0315
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly hydrolyzes specific sugar (hydrolyzation of glycosidic bond) and could be involved in exopolysaccharide biosynthesis/degradation. Could also have a LYTIC activity against cell WALLS. |
| Product | Possible beta-1,3-glucanase precursor |
| Comments | Rv0315, (MTCY63.20), len: 294 aa. Possible beta-1,3-glucanase precursor (has hydrophobic stretch in its N-terminal part), similar to others e.g. Q51333|AAC44371.1 beta-1,3-glucanase II a from Oerskovia xanthineolytica (306 aa), FASTA scores: opt: 76, E(): 3e-14, (34.1% identity in 302 aa overlap); and AAC38290.1|AF052745 beta-1,3-glucanase II from Oerskovia xanthineolytica (435 aa). Contains glycosyl hydrolases family 16 active site signature (PS01034). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 383602 | 384486 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0315|Rv0315
MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPAPAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQNVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMYFWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYKVFPVLNLAVGGSGGGDPATGSYPQEMLVDWVRVF
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- González-Zamorano M et al. [2009]. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant