Gene Rv0318c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv0318c, (MTCY63.23c), len: 264 aa. Probable conserved integral membrane protein, with some similarity to C-terminus of GUFA_MYXXA|Q06916 (254 aa), FASTA scores: opt: 157, E (): 0.0032, (28.3% identity in 198 aa overlap). Also similar to O26573 conserved protein from Methanobacterium thermoauto (259 aa), FASTA scores: opt: 173, E(): 5.2e-05, (32.7% identity in 214 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 386305 | 387099 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0318c|Rv0318c
LSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGGVVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVALRRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEVLFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAAGALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
