Gene Rv0323c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0323c, (MTCY63.28c), len: 223 aa. Conserved hypothetical protein, similar to others e.g. YPJG_BACSU|P42981 hypothetical 24.8 kDa protein from Bacillus subtilis (224 aa), FASTA scores: opt: 182, E(): 1.3e-05, (27.5% identity in 211 aa overlap). Also some similarity to MLU15183_8 from Mycobacterium tuberculosis FASTA score: (32.0% identity in 147 aa overlap). Alternative nucleotide at position 390828 (T->C; S142G) has been observed. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 390580 | 391251 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0323c|Rv0323c
MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLCFTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVVDALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPSIPVLAWALPQPIADRLNAEFSASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSVP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant