Gene Rv0329c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0329c, (MTCY63.34c), len: 208 aa. Conserved hypothetical protein, showing some similarity with others hypothetical proteins and methyltransferases e.g. MitM|AF127374_14 methyltransferase from Streptomyces lavendulae (283 aa), FASTA scores: opt: 242, E(): 1.8e-08, (37.2% identity in 145 aa overlap); Q48938 from Methanosarcina barkeri (262 aa), FASTA scores: opt: 194, E(): 3.6e-06, (31.1% identity in 119 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 394694 | 395320 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0329c|Rv0329c
MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELLAPGPGERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLISLYHGDGVTLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLVLTSISDDQPLAARFDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPATVWFTATAT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant