Gene Rv0331
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible dehydrogenase/reductase |
| Comments | Rv0331, (MTCY63.36), len: 388 aa. Possible dehydrogenase/reductase, similar to various dehydrogenases/reductases e.g. NP_103779.1|14022957|BAB49565.1|AP002999 flavoprotein reductase from Mesorhizobium loti (377 aa); NP_147681.1 predicted NAD(FAD)-dependent dehydrogenase from Aeropyrum pernix (381 aa); DHSU_CHRVI|Q06530 sulfide dehydrogenase (431 aa), FASTA scores: opt: 347, E(): 6.8e-15, (25.6% identity in 348 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: up-regulated at high temperatures, and up-regulated after 24h of starvation (see citations below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 396201 | 397367 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0331|Rv0331
MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLSLLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIALGAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAAPFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRKALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSADNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYVETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
