Gene Rv0385
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable monooxygenase |
| Comments | Rv0385, (MTV036.20), len: 390 aa. Probable monooxygenase, similar to T37003|5738846|CAB52917.1|AL109949 probable flavohemoprotein from Streptomyces coelicolor (435 aa); and similar in part (C-termini) to various monooxygenases e.g. P19734|DMPP_PSESP|94993|F37831 phenol hydroxylase P5 protein (phenol 2-monooxygenase P5 component) from Pseudomonas putida (353 aa), FASTA scores: opt: 363, E(): 4.2e-16, (31.8% identity in 255 aa overlap); S47292|2120861|pir|S70085 phenol 2-monooxygenase chain mopP from Acinetobacter calcoaceticus (350 aa); P21394|XYLA_PSEPU|94933|B37316 xylene monooxygenase electron transfer component [includes: ferredoxin; ferredoxin--NAD(+) reductase] from Pseudomonas putida plasmid pWW0 (350 aa); AAC38360.1|AF043544|NtnMA|ntnA reductase component of 4-nitrotoluene monooxygenase from Pseudomonas sp. (328 aa); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 462135 | 463307 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0385|Rv0385
VGLEDRDALRVLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPDMGAQRAAFGQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTLRDYLGHPSRGAWTDAVDEAAGQSLNLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLAVARLQLDRPLHYYPGQYVNVHVPQCPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNAIVGETRPGDRWRLSGPHGAFRVDRDGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHLFFGARYACELYDLPTLWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTGRLPDVVSRYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
