Gene Rv0438c (moeA3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in molybdenum cofactor biosynthesis: involved in the biosynthesis of a demolybdo-cofactor (molybdopterin), necessary for molybdo-enzymes. |
| Product | Probable molybdopterin biosynthesis protein MoeA2 |
| Comments | Rv0438c, (MTV037.02c), len: 405 aa. Probable moeA2, molybdenum cofactor biosynthesis protein, highly similar to many e.g. Y10817|ANY10817_2 from A. nicotinovorans (429 aa), FASTA scores: opt: 786, E(): 0, (39.2% identity in 398 aa overlap); etc. Also similar to MOEA1|Rv0994|MTCI237.08|O05577 probable molybdopterin biosynthesis protein from Mycobacterium tuberculosis (426 aa), FASTA scores: opt: 667, E(): 2e-32, (36.5% identity in 425 aa overlap). Note that previously known as moeA3. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 526143 | 527360 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0438c|moeA2
VRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPVFDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPTGATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAAALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATATAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVAMQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTASLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQLQVWDLT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
