Gene Rv0447c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge [catalytic activity: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid]. |
| Product | Probable cyclopropane-fatty-acyl-phospholipid synthase UfaA1 (cyclopropane fatty acid synthase) (CFA synthase) |
| Comments | Rv0447c, (MTV037.11c), len: 427 aa (start uncertain). Probable ufaA1, cyclopropane-fatty-acyl-phospholipid synthase, similar to others e.g. NP_102178.1|14021351|BAB47964.1|AP002994 cyclopropane-fatty-acyl-phospholipid synthase from Mesorhizobium loti (378 aa); B82240|9655593|AAF94281.1|AE004192 cyclopropane-fatty-acyl-phospholipid synthase from Vibrio cholerae (432 aa); P30010|CFA_ECOLI cyclopropane-fatty-acyl-phospholipid synthase from Escherichia coli strain K-12 (382 aa); X55704|PPLPD_3 LPD-3 from P.putida (394 aa), FASTA scores: opt: 556, E(): 2.8e-30, (33.3% identity in 387 aa overlap); AE0005|HPAE000557_9 from Helicobacter pylori (389 aa), FASTA scores: opt: 539, E(): 3.9e-29, (34.3% identity in 382 aa overlap). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 535224 | 536507 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0447c|ufaA1
MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTATHLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKELTRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGELCIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEMIEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLPSTQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWELYLAYSEAGFRSGYLDVYQWTLIREGPP
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
