Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0448c, (MTV037.12c), len: 221 aa. Conserved hypothetical protein, similar to other hypothetical proteins e.g. Z74841|BOD5A2_1 from B. oleracea (283 aa), FASTA scores: opt: 257, E(): 1.4e-10, (32.0% identity in 197 aa overlap); etc. Some similarity to U15183|MLU15183_38 from Mycobacterium leprae (82 aa), FASTA scores: opt: 134, E(): 0.014, (71.0% identity in 31 aa overlap).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS536504537169-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0448c|Rv0448c
VHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCPPHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRHVIAEVHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPDRELDVTVTLHRDRRQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVVAARIRIQGIRLWLRRVPVVPR