Gene Rv0457c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; hydrolyzes peptides and/or proteins. |
| Product | Probable peptidase |
| Comments | Rv0457c, (MTCI429A.01, MTV038.01c), len: 673 aa. Probable peptidase, similar to many e.g. NP_102851.1|14022026|BAB48637.1 probable endopeptidase from Mesorhizobium loti (687 aa); Y4NA_RHISN|P55577 probable peptidase (726 aa), FASTA scores: opt: 1126, E(): 0, (40.9% identity in 491 aa overlap). Also similar to Mycobacterium tuberculosis protein MTCY369.26 FASTA score: (33.8% identity in 299 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 547586 | 549607 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0457c|Rv0457c
MTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDAEFERMRVEALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGWDVLIDVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFDMLTREFVEDGFQLPPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKRWRRGKPLADAETIFEGAGTDVRVNASADRTPGFERTLLGRALDFWNEEVYELRGSELIRIEAPTDASVSIHRDWLLIELRTDWTVATTRYTAGSLLAAEYDEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTLADVASRVEIATPGSWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTDDGRLAEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNGYGGFETSRTPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREGRDKVAQDFAAVATDLVTRGITTAEQLGARGGSNGGLLMGIMLTGYPEKFGALVCDVPLLDMKRYHLLLAGASWMAEYGDPDNPDDWKFISEYSPYQNISANRKYPPVLMTTSTRDDRVHPGHARKMTAALQAAGHPVWYYENIEGGHAGAADNAQIAFKSALSFAFLWRMLAG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant