Gene Rv0460
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hydrophobic protein |
| Comments | Rv0460, (MTV038.04), len: 79 aa. Conserved hydrophobic protein, highly similar AAA63024.1|U15183 hypothetical protein from Mycobacterium leprae (56 aa), FASTA scores: opt: 197, E(): 3.7e-09, (63.8% identity in 47 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 551749 | 551988 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0460|Rv0460
MLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
