Gene Rv0466
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv0466, (MTV038.10), len: 264 aa. Conserved protein, equivalent to CAC31980.1|AL583925 conserved hypothetical protein from Mycobacterium leprae (264 aa). Similar to Rv2001|Z74025|MTCY39.17c hypothetical 28.7 KDA protein from Mycobacterium tuberculosis (250 aa), FASTA scores: opt: 592, E(): 0, (38.0% identity in 263 aa overlap). Some similarity to several thioesterases e.g. Q42561|ATACPTE17_1 acyl-(acyl carrier protein) thioester from A. thaliana (362 aa), FASTA scores: E(): 0.0092, (24.4% identity in 197 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 556458 | 557252 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0466|Rv0466
VSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQDIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVDGRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASEIHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEIISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
