Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0466, (MTV038.10), len: 264 aa. Conserved protein, equivalent to CAC31980.1|AL583925 conserved hypothetical protein from Mycobacterium leprae (264 aa). Similar to Rv2001|Z74025|MTCY39.17c hypothetical 28.7 KDA protein from Mycobacterium tuberculosis (250 aa), FASTA scores: opt: 592, E(): 0, (38.0% identity in 263 aa overlap). Some similarity to several thioesterases e.g. Q42561|ATACPTE17_1 acyl-(acyl carrier protein) thioester from A. thaliana (362 aa), FASTA scores: E(): 0.0092, (24.4% identity in 197 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS556458557252+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0466|556458-557252|+|Rv0466|downstream:0|upstream:0
gtgagcctcgacaaaaaattgatgcccgtgcccgacggtcaccccgacgtgttcgaccgagaatggccgctgcgcgtcggcgacatcgaccgcgcgggccggctgcggctggacgcggcttgtcggcacatccaggacatcggtcaggaccaactgcgcgagatgggcttcgaggagacccacccgctgtggatcgtccgcaggaccatggtggaccttatccggccgatcgagttcggcgacatgctgcggtgtcggcgctggtgctcgggcacctccaaccggtggtgtgagatgcgagttcgtgtcgatggccgcaagggcggcctgatcgaatccgaggcgttctggatccacgtcaaccgggaaaccgagatgccggcccgcattgccgacgacttcctcgcgggtctgcaccggaccacgtctgttgatcggctgcgctggaagggctatctgaagccgggcagccgggatgatgcgtcggagatccacgagttcccggtccgggtcaccgatatcgacttgttcgaccacatgaacaacgctgtctattggagtgtgatcgaggactacctggcgtcgcatgcagagctgctgcggggccctttgcgggtgaccatcgagcatgaggcgccggttgcgctcggcgacaagctggagatcatctcccacgttcacccggctggttcgaccgagatattcggcccggggttggtcgaccgcgctgttacaacgctcacatatgtggttggcgacgagcccaaggcagtcgcctcgctgttcaatctgtga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0466|Rv0466
VSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQDIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVDGRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASEIHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEIISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL