Gene Rv0488
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; possibly involved in transport of lysine across the membrane. |
| Product | Probable conserved integral membrane protein |
| Comments | Rv0488, (MTCY20G9.14), len: 201 aa. Probable conserved integral membrane protein, LysE family possibly involved in transport of Lysine, similar to others and conserved hypothetical proteins e.g. AB93746.1|AL357613 putative membrane transport protein from Streptomyces coelicolor (204 aa); D83100|PA4365 probable transporter from Pseudomonas aeruginosa (200 aa); YGGA_ECOLI|P11667 hypothetical 21.7 kDa protein from Escherichia coli (197 aa), FASTA scores: opt: 382, E(): 1.1e-19, (39.1% identity in 179 aa overlap); CGLYSEG_2 C|P94633 lysine exporter protein (236 aa), FASTA scores: E(): 2.3e-07, (33.3% identity in 219 aa overlap). Also similar to Rv1986 from Mycobacterium tuberculosis. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 577664 | 578269 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0488|Rv0488
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
