Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown; possibly involved in transport of lysine across the membrane.
ProductProbable conserved integral membrane protein
CommentsRv0488, (MTCY20G9.14), len: 201 aa. Probable conserved integral membrane protein, LysE family possibly involved in transport of Lysine, similar to others and conserved hypothetical proteins e.g. AB93746.1|AL357613 putative membrane transport protein from Streptomyces coelicolor (204 aa); D83100|PA4365 probable transporter from Pseudomonas aeruginosa (200 aa); YGGA_ECOLI|P11667 hypothetical 21.7 kDa protein from Escherichia coli (197 aa), FASTA scores: opt: 382, E(): 1.1e-19, (39.1% identity in 179 aa overlap); CGLYSEG_2 C|P94633 lysine exporter protein (236 aa), FASTA scores: E(): 2.3e-07, (33.3% identity in 219 aa overlap). Also similar to Rv1986 from Mycobacterium tuberculosis.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS577664578269+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0488|Rv0488
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII