Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0496, (MTCY20G9.22), len: 328 aa. Conserved hypothetical protein, highly similar to S72894|467046|AAA17230.1|U00018 exopolyphosphatase ppx from Mycobacterium leprae (406 aa), FASTA scores: opt: 1902, E(): 0, (86.6% identity in 343 aa overlap); and P54882|Y496_MYCLE|ML2434|13094008|CAC31951.1|AL583925 hypothetical 36.2 KDA protein from Mycobacterium leprae (339 aa). Also highly similar to hypothetical proteins and exopolyphosphatases e.g. Q9X8H1|Y715_STRCO|SCE7.15c hypothetical protein from Streptomyces coelicolor (309 aa). C-terminal region similar to CGU31224_1|Q46054 protein similar to ppx gene product of Mycobacterium leprae from Cornybacterium glutamicum (140 aa), FASTA scores: opt: 615, E(): 2.7e-33, (70.9% identity in 134 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS586394587380+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0496|Rv0496
VVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTIDEFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGAAPSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMRALSIEAVEICPWALREGLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSRGSKP