Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0502, (MTCY20G9.29), len: 358 aa. Conserved protein, equivalent to P54878|Y502_MYCLE|ML2427 hypothetical 40.5 KDA protein from Mycobacterium leprae (367 aa), FASTA scores: opt: 2042, E(): 0, (84.1% identity in 365 aa overlap). Also similar to T36273|SCE68.23c hypothetical protein from Streptomyces coelicolor (355 aa). C-terminal similar to AL021529|SC10A5_4|T34572 hypothetical protein from Streptomyces coelicolor (295 aa), FASTA score: (57.8% identity in 263 aa overlap); and to hypothetical proteins from Mycobacterium tuberculosis Rv1920|G70808 (287 aa); and Rv1428c|G70914 (275 aa).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS592791593867+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0502|Rv0502
MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPNDRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDEFGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSVAVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRETIQQTLYRLLAGRRNIFFG