Gene Rv0520
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could cause methylation. |
| Product | Possible methyltransferase/methylase (fragment) |
| Comments | Rv0520, (MTCY20G10.10), len: 116 aa. Possible fragment of methyltransferase (possibly first part), highly similar to part of several methyltransferases e.g. Q43445|U43683 S-adenosyl-L-methionine:DELTA24-sterol-C-methyltransferase from Glycine max (Soybean)(367 aa), FASTA scores: opt: 190, E(): 2.3e-12, (39.2% identity in 74 aa overlap). Also some similarity to MTCY19G5_5 from Mycobacterium tuberculosis. Possibly continues as Rv0521 but we can find no frameshift to account for this. |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 612255 | 612605 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0520|Rv0520
MGGCSITCLNISEVPNETNRKKNRQAGLDRSIRVIHGSFDDIPEPDSGYDVVWSQDAILHAPDRRKVLEEAFRVLRPGGELIFTDPMQADDVPDGVLQPVYDRLNLRDLGSMRFYA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
