Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould cause methylation.
ProductPossible methyltransferase/methylase (fragment)
CommentsRv0520, (MTCY20G10.10), len: 116 aa. Possible fragment of methyltransferase (possibly first part), highly similar to part of several methyltransferases e.g. Q43445|U43683 S-adenosyl-L-methionine:DELTA24-sterol-C-methyltransferase from Glycine max (Soybean)(367 aa), FASTA scores: opt: 190, E(): 2.3e-12, (39.2% identity in 74 aa overlap). Also some similarity to MTCY19G5_5 from Mycobacterium tuberculosis. Possibly continues as Rv0521 but we can find no frameshift to account for this.
Functional categoryIntermediary metabolism and respiration
TranscriptomicsDNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS612255612605+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0520|Rv0520
MGGCSITCLNISEVPNETNRKKNRQAGLDRSIRVIHGSFDDIPEPDSGYDVVWSQDAILHAPDRRKVLEEAFRVLRPGGELIFTDPMQADDVPDGVLQPVYDRLNLRDLGSMRFYA