Gene Rv0539
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Substrate (sugar) unknown [catalytic activity: NDP-sugar + dolichyl phosphate = NDP + dolichyl sugar phosphate]. |
| Product | Probable dolichyl-phosphate sugar synthase (dolichol-phosphate sugar synthetase) (dolichol-phosphate sugar transferase) (sugar phosphoryldolichol synthase) |
| Comments | Rv0539, (MTCY25D10.18), len: 210 aa. Probable dolichol-P-sugar synthase, highly similar to CAB76989.1|AL159178 putative glycosyltransferase from Streptomyces coelicolor (242 aa), and similar to various dolichol-P-sugar synthetases and sugar transferases e.g. NP_126257.1|NC_000868 dolichyl-phosphate mannose synthase related protein from Pyrococcus abyssi (211 aa); N-terminus of NP_127133.1|NC_000868 dolichol-P-glucose synthetase from Pyrococcus abyssi (378 aa); N-terminus of NP_068880.1|NC_000917 putative dolichol-P-glucose synthetase from Archaeoglobus fulgidus (369 aa), FASTA scores: E(): 2.4e-13, (32. 1% identity in 193 aa overlap); Q26732 dolichyl-phosphate-mannose synthase precursor from trypanosoma brucei (267 aa), FASTA scores: opt: 179, E(): 0.0011, (30.7% identity in 205 aa overlap); etc. Also similar to Rv2051c|MTY25D10_18 from Mycobacterium tuberculosis. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 631743 | 632375 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0539|Rv0539
VLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTATVAARHGAQVVVEPRPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGADLVTGRRRPVAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDLGVVDRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSIIAILDFWKVIS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
