Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0571c, (MTV039.09c), len: 443 aa. Conserved protein, highly similar to the products of two adjacent orfs in Mycobacterium leprae: AAA63059.1|U15184|U650S|Q50111 hypothetical protein (258 aa), FASTA scores: opt: 1071, E(): 0, (72.5% identity in 233 aa overlap); and AAA63058.1|U15184|U650T hypothetical protein (86 aa), FASTA scores: opt: 192, E(): 6.4e-06, (70.8% identity in 48 aa overlap). Also similar to others e.g. NP_107072.1|NC_002678 hypothetical protein from Mesorhizobium loti (235 aa); NP_213031.1|NC_000918 hypothetical protein from Aquifex aeolicus (175 aa); etc. And similar to part of hypothetical proteins from Mycobacterium tuberculosis e.g. C-terminus of Rv2143|MTCY270.25c|Z95388|NP_216659.1|NC_000962 (352 aa), FASTA scores: opt: 592, E(): 7e-32, (49.3% identity in 205 aa overlap); N-terminus of Rv2030c|NP_216546.1|NC_000962 (681 aa).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS663487664818-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0571c|Rv0571c
MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKSLQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIELQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPDDIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDAAADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGAGFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAGAALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVIPGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG