Gene Rv0605
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Prevents the cointegration of foreign DNA before integration into the chromosome. |
| Product | Possible resolvase |
| Comments | Rv0605, (MTCY19H5.17c), len: 202 aa. Possible resolvase for IS_Y349 element, similar to several Mycobacterial hypothetical proteins and weakly similar to Q52563 resolvase from Pseudomonas syringae (210 aa), FASTA scores: opt: 99, E(): 3.1, (35.7% identity in 98 aa overlap). Contains PS00397 Site-specific recombinases active site and probable helix-turn helix motif from aa 9-30 (Score 1815, +5.37 SD). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Proteomics | The product of this CDS corresponds to spot 3_277 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 701406 | 702014 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0605|Rv0605
VACCRNRGMNLAAWAERNGVARVTAYRWFHAGLLPVPARKVGRLILVDELASEAGAQPKTAVYARVSSADQKSDLDRQVARVTSWATAEQIPVDKVVTEVGSVLNGHRRKFPAVLRDLSVTRIVVEHRDRFCRFGSEYVHAALAAQGRELVVVDSAEVDDDLVWDMTEILTSMCARLYGKRAAQNRAKRAVAAAAVDDHEAA
Bibliography
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant