Gene Rv0643c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in mycolic acids modification. Catalyzes unusual S-adenosyl-methionine-dependent transformation of a cis-olefin mycolic acid into a secondary alcohol. Catalyzes introduction of a hydroxyl group at the distal position on mycolic acid chains to produce the hydroxyl mycolate. Mycolic acids represent a major constituent of the mycobacterial cell wall complex. Methyl transfer results in formation of a secondary hydroxy group with an adjacent methyl branch; olefinic mycolic acid methyl transferase. |
| Product | Methoxy mycolic acid synthase 3 MmaA3 (methyl mycolic acid synthase 3) (MMA3) (hydroxy mycolic acid synthase) |
| Comments | Rv0643c, (MTCY20H10.24c), len: 293 aa. MmaA3, methoxy mycolic acid synthase 3 (methyltransferase) (see citations below). Equivalent to AAC44875|AAC44875.1|cmaB methyl transferase (mycolic acid modification protein) from Mycobacterium bovis BCG strain Pasteur (289 aa); and highly similar to others from Mycobacteria e.g. upstream ORF P72028|mmaA4|Rv0642c|MTCY20H10.23c putative methoxy mycolic acid synthase 4 from Mycobacterium tuberculosis (301 aa). |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 737268 | 738149 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0643c|mmaA3
MSDNSTGTTKSRSNVDDVQAHYDLSDAFFALFQDPTRTYSCAYFERDDMTLHEAQVAKLDLTLGKLGLEPGMTLLDVGCGWGSVMKRAVERYDVNVVGLTLSKNQHAYCQQVLDKVDTNRSHRVLLSDWANFSEPVDRIVTIEAIEHFGFERYDDFFKFAYNAMPADGVMLLHSITGLHVKQVIERGIPLTMEMAKFIRFIVTDIFPGGRLPTIETIEEHVTKAGFTITDIQSLQPHFARTLDLWAEALQAHKDEAIEIQSAEVYERYMKYLTGCAKAFRMGYIDCNQFTLAK
Bibliography
- Yuan Y and Barry III CE [1996]. A common mechanism for the biosynthesis of methoxy and cyclopropyl mycolic acids in Mycobacterium tuberculosis. Sequence Function
- Kremer L, Baulard AR and Besra GS [2000]. Review
- Cole ST et al. [2001]. Massive gene decay in the leprosy bacillus. Secondary Function
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
