Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in respiration; catalyzes conversion of lactate into pyruvate [catalytic activity: (S)-lactate + 2 ferricytochrome C = pyruvate + 2 ferrocytochrome C].
ProductPossible L-lactate dehydrogenase (cytochrome) LldD1
CommentsRv0694, (MTCY210.11), len: 396 aa. Possible lldD1, L-lactate dehydrogenase (cytochrome), similar to NP_302368.1|NC_002677 L-lactate dehydrogenase from Mycobacterium leprae (414 aa). Also similar to others e.g. NP_384560.1|NC_003047 putative L-lactate dehydrogenase (cytochrome) protein from Sinorhizobium meliloti (403 aa); NP_251072.1|NC_002516 L-lactate dehydrogenase from Pseudomonas aeruginosa (383 aa); P33232|LLDD_ECOLI L-lactate dehydrogenase (cytochrome) from Escherichia coli strain K12 (396 aa), FASTA scores: opt: 697, E(): 0, (34.5 identity in 380 aa overlap); etc; and also similar to other oxidoreductases. Note that also highly similar to RSU17129_5|AAC77479.1|U17129 unknown protein from Rhodococcus erythropolis (392 aa), FASTA scores: opt: 2006, E(): 0, (74.1% identity in 386 aa overlap). Also similar to lldD2|Rv1872c|MTCY180.46|MTCY359.01 possible L-lactate dehydrogenase (cytochrome) from Mycobacterium tuberculosis (414 aa). Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenases family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS793335794525+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0694|lldD1
VAEAWFETVAIAQQRAKRRLPKSVYSSLIAASEKGITVADNVAAFSELGFAPHVIGATDKRDLSTTVMGQEVSLPVIISPTGVQAVDPGGEVAVARAAAARGTVMGLSSFASKPIEEVIAANPKTFFQVYWQGGRDALAERVERARQAGAVGLVVTTDWTFSHGRDWGSPKIPEEMNLKTILRLSPEAITRPRWLWKFAKTLRPPDLRVPNQGRRGEPGPPFFAAYGEWMATPPPTWEDIGWLRELWGGPFMLKGVMRVDDAKRAVDAGVSAISVSNHGGNNLDGTPASIRALPAVSAAVGDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAANGQAGVENVLDILRGGIDSALMGLGHASVHDLSPADILVPTGFIRDLGVPSRRDV