Gene Rv0695
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0695, (MTCY210.12), len: 251 aa. Conserved hypothetical protein, similar to many creatinine amidohydrolases or hypothetical proteins e.g. NP_443048.1|NC_000911 creatinine amidohydrolase from Synechococcus sp. PCC 6803 (273 aa); NP_466169.1|NC_003210 protein similar to creatinine amidohydrolase from Listeria monocytogenes (249 aa); T35153|SC5A7.04c hypothetical protein from Streptomyces coelicolor (273 aa); etc. Note that highly similar to RSU17129_10|AAC77474.1|U17129 unknown protein from Rhodococcus erythropolis (230 aa), FASTA scores: opt: 693, E(): 0, (55.7% identity in 237 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 794715 | 795470 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0695|Rv0695
VNSSYHRRVPVVGELGSATSSQLPSTSPSIVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEHQRFAGTISIGTEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGRDAGWCPCTCPGGDPHAGHTETSVLLHLSPADVRTERWRAGNRAPLPVLLPSMRRGGVAAVSETGVLGDPTTATAAEGRRIFAAMVDDCVRRVARWMPQPDGMLT
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant