Gene Rv0724A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0724A, len: 111 aa. Similarity suggests that this CDS should be continuation of Rv0725c but we can find no frame-shift to account for this. Possible extended protein is very similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv1729c|Z81360_12 (312 aa), FASTA scores: opt: 399, E(): 2e-19, (58.7% identity in 109 aa overlap); Rv0731c, Rv0726c, etc. Frame-shift could occur at nt 817866. Same sequence for strain CDC1551 and Mycobacterium bovis. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 817531 | 817866 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0724A|Rv0724A
SQDRLFDNSTELSVAGSTIATELVPGIVDFDAGRVREMADSFRKHGVDIDMASLVYSGERSHVVDYLRAKGWDVEGTVRTDLFRRNGLPVPAPHDDDPLGEIIFISGRLNG
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
