Gene Rv0755A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could be required for the transposition of an insertion element. |
| Product | Putative transposase (fragment) |
| Comments | Rv0755A, len: 61 aa. Putative transposase (possibly gene fragment), similar to C-terminal part of Q9EZM2|ISMav2|AF286339_1 putative transposase from Mycobacterium paratuberculosis (395 aa), FASTA scores: opt: 284, E(): 5e-13, (83.02% identity in 53 aa overlap); and to SCJ11.25c|Q9RI80 possible noncomposite transposon transposase from Streptomyces coelicolor (283 aa). |
| Functional category | Insertion seqs and phages |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 850342 | 850527 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0755A|Rv0755A
MKELSVAEQRYQAVLAVISDGLSISQVAEKVGVSRQTLHTWLARYEAEGLDGLRIGTGTAL
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
