Gene Rv0784
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0784, (MTC369.28), len: 228 aa. Conserved hypothetical protein, with some similarity to MLCB5_20|O05752 hypothetical protein from Mycobacterium leprae (193 aa), FASTA scores: opt: 141, E(): 0.0022, (36.0% identity in 114 aa overlap). Also similar to N-terminus of NP_253002.1|NC_002516 conserved hypothetical protein from Pseudomonas aeruginosa (253 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 878638 | 879324 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0784|Rv0784
VSVSGIGESTLADVDAFCAEMDARSVPVSLLVAPRMRDDYRLDRDPRTVDWLTGRRAAGDALVLHGYDEAATKRRRGEFAMLRAHEANLRLMAADRVLEHLGLRTRLFAAPGWLVSPGVRTALPANGFRLLADLHGITDLVRLTTVRARVLGIGEGFLAEPWWCRMVVMSAERIARRGGVVRIAVAARHLRKSGPLQAMLDAVDLAMLQGCTPMVYRWRADAAVLDAA
Bibliography
- Sinha S et al. [2002]. Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
