Gene Rv0791c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv0791c, (MTV042.01c, MTCY369.35c), len: 347 aa. Conserved protein, similar (except in N-terminus) to others e.g. CAC44585.1|AL596162 conserved hypothetical protein from Streptomyces coelicolor (307 aa); NP_252643.1|NC_002516 hypothetical protein from Pseudomonas aeruginosa (364 aa); etc. Also some similarity with oxidoreductases e.g. AAK38097.1|AF323606_3|AF323606 putative F420-dependent dehydrogenase from Rhodococcus erythropolis (295 aa); etc. And also similar in part to other proteins from Mycobacterium tuberculosis e.g. Rv1855c|MTCY359.18|Z83859 (307 aa), FASTA scores: opt: 366, E(): 4e-16, (35.0% identity in 226 aa overlap); Rv3079c|MTCY22D7.02|Z83866 conserved hypothetical protein (275 aa), FASTA scores: opt: 342, E(): 1.2e-14, (31.6% identity in 234 aa overlap); Rv0044c possible oxidoreductase (264 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 884797 | 885840 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0791c|Rv0791c
MNAKDDPHFGLMLAATVNGLAVGSYREMVVVSQTAEEYGFDSVWLCDHFLTISPGEYAKVAGIAADTGSATGTETGGAGQCAPSRSLPLLECWTALAALSRDTTKLRLGTSVLCNSYRHPSVLAKMAATLDVISQGRLDLGLGAGWFRRESQAYGIPFPPVGDRVSALAESLQVIKAVWTEPNPTYAGRFYTLDGATCDPPPVQRPHPPLWIGGEGDRVQRIAAKHAQGLNVRWWSPQQVTQRRGFLTQASEAAGRDPDTLRLSVTLLLAPTQSGEEEVRIREEFASIPEPGLIVGTPDRCVERIREYQDRGVGHFLFTIPHVVKSDYLHIIGSDIIPRVKTEVTIP
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant