Gene Rv0795
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS6110. |
| Product | Putative transposase for insertion sequence element IS6110 (fragment) |
| Comments | Rv0795, (MTV042.05), len: 108 aa. Putative transposase for IS6110 (fragment), identical to Q50686 insertion element IS6110 (108 aa), FASTA score: (100.0 % identity in 108 aa overlap). The transposase described here may be made by a frame shifting mechanism during translation that fuses Rv0795 and Rv0796, the sequence UUUUAAAG (directly upstream of Rv0796) maybe responsible for such a frameshifting event (see McAdam et al., 1990). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 889072 | 889398 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0795|Rv0795
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
Bibliography
- Thierry D et al. [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. Sequence
- McAdam RA, Hermans PW, van Soolingen D, Zainuddin ZF, Catty D, van Embden JD and Dale JW [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence belonging to the IS3 family. Sequence
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
