Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0810c, (MTV043.02c), len: 60 aa. Conserved hypothetical protein, with its N-terminus highly similar to NP_302445.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (62 aa); and AL118514|SCD25_24 hypothetical protein from Streptomyces coelicolor (84 aa), FASTA scores: opt: 180, E(): 5.7e-07, (51.8% identity in 56 aa overlap).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS904905905087-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0810c|Rv0810c
MGRGRAKAKQTKVARELKYSSPQTDFQRLQRELSGTGTDRLDGDGPSDDDSWNDEDDWRR