Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionActs on amino acids.
ProductProbable amino acid aminotransferase
CommentsRv0812, (MTV043.04), len: 289 aa. Probable amino acid aminotransferase, similar to other amino acid aminotransferases, generelly class-IV of pyridoxal-phosphate-dependent aminotransferases, and especially ILVE proteins and PABC proteins e.g. B76065.1|AL157953 putative aminotransferase from Streptomyces coelicolor (273 aa); NP_069766.1|NC_000917 branched-chain amino acid aminotransferase (ilvE) from Archaeoglobus fulgidus (290 aa); P54692|DAAA_BACLI D-alanine aminotransferase from Bacillus licheniformis (283 aa); P28305|PABC_ECOLI|B1096 4-amino-4-deoxychorismate lyase (ADC lyase) From Escherichia coli strain K12 (269 aa), FASTA scores: opt: 165, E(): 0.00064, (26.8% identity in 198 aa overlap); etc. Note that previously known as pabC.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantDisruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS906423907292+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0812|Rv0812
VVVTLDGEILQPGMPLLHADDLAAVRGDGVFETLLVRDGRACLVEAHLQRLTQSARLMDLPEPDLPRWRRAVEVATQRWVASTADEGALRLIYSRGREGGSAPTAYVMVSPVPARVIGARRDGVSAITLDRGLPADGGDAMPWLIASAKTLSYAVNMAVLRHAARQGAGDVIFVSTDGYVLEGPRSTVVIATDGDQGGGNPCLLTPPPWYPILRGTTQQALFEVARAKGYDCDYRALRVADLFDSQGIWLVSSMTLAARVHTLDGRRLPRTPIAEVFAELVDAAIVSDR