Gene Rv0821c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional regulation of active transport of inorganic phosphate across the membrane. |
| Product | Probable phosphate-transport system transcriptional regulatory protein PhoY2 |
| Comments | Rv0821c, (MTV043.13c), len: 213 aa. Probable phoY2, phosphate-transport system regulatory protein, highly similar to PhoY|MLU15182_29|U15182 phosphate transport system regulator from Mycobacterium leprae (222 aa), FASTA scores: opt: 1268, E(): 0, (93.0% identity in 213 aa overlap). Also similar to others e.g. NP_384620.1|NC_003047 probable phosphate transport system transcriptional regulator protein from Sinorhizobium meliloti (237 aa); etc. Also highly similar to MTCI418A.03c|Z96070|PhoY1 probable phosphate transport system transcriptional regulator protein from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 937, E(): 0, (63.4% identity in 213 aa overlap). Belongs to the PhoU family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 913558 | 914199 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0821c|phoY2
MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEVARRVIFQATGAFP
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant