Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossible methyltransferase
ProductPossible S-adenosylmethionine-dependent methyltransferase
CommentsRv0830, (MTV043.22), len: 301 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), member of Mycobacterium tuberculosis protein family consisting of the proteins Rv0726c, Rv0731c, Rv3399, Rv1729c|Z81360|MTCY4C12_14c (312 aa), FASTA scores: opt: 1014, E(): 0, (54.1% identity in 292 aa overlap); etc.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS921970922875+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0830|Rv0830
MVRADRDRWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGDSEFDPQRMATGMACRTRFFDQFFLDATHSGIGQFVILASGLDARAYRLAWPVGSIVYEVDMPEVIEFKTATLSDLGAEPATERRTVAVDLRDDWATALQTAGFDPKVPAAWSAEGLLVYLPVEAQDALFDNITALSAPGSRLAFEFVPDTAIFADERWRNYHNRMSELGFDIDLNELVYHGQRGHVLDYLTRDGWQTSALTVTQLYEANGFAYPDDELATAFADLTYSSATLMR