Gene Rv0830
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possible methyltransferase |
| Product | Possible S-adenosylmethionine-dependent methyltransferase |
| Comments | Rv0830, (MTV043.22), len: 301 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), member of Mycobacterium tuberculosis protein family consisting of the proteins Rv0726c, Rv0731c, Rv3399, Rv1729c|Z81360|MTCY4C12_14c (312 aa), FASTA scores: opt: 1014, E(): 0, (54.1% identity in 292 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 921970 | 922875 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0830|Rv0830
MVRADRDRWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGDSEFDPQRMATGMACRTRFFDQFFLDATHSGIGQFVILASGLDARAYRLAWPVGSIVYEVDMPEVIEFKTATLSDLGAEPATERRTVAVDLRDDWATALQTAGFDPKVPAAWSAEGLLVYLPVEAQDALFDNITALSAPGSRLAFEFVPDTAIFADERWRNYHNRMSELGFDIDLNELVYHGQRGHVLDYLTRDGWQTSALTVTQLYEANGFAYPDDELATAFADLTYSSATLMR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Graña M et al. [2007]. The crystal structure of M. leprae ML2640c defines a large family of putative S-adenosylmethionine-dependent methyltransferases in mycobacteria. Function
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
