Gene Rv0852
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but involved in lipid degradation. |
| Product | Possible fatty-acid-CoA ligase FadD16 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase) |
| Comments | Rv0852, (MTV043.45), len: 278 aa. Possible fadD16, fatty-acid-CoA synthetase, similar in part to various CoA ligases e.g. P18163|LCFB_RAT long-chain-fatty-acid--CoA ligase from Rattus norvegicus (Rat) (699 aa); D49366|LEP4CCOALA_1 4-coumarate:CoA ligase from Lithospermum erythrorhizon (636 aa), FASTA scores: opt: 134, E(): 0.15, (26.8% identity in 213 aa overlap); orgp|L09229|HUMFACAL_1 long-chain acyl-coenzyme A from homo sapiens (human) (699 aa), FASTA score: (50.0% identity in 40 aa overlap); etc. Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2. |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 948559 | 949395 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0852|fadD16
VFTIGYSCASRGADSWLIRRCSVVQGCLDDPGATVEAIDDDGWPHTGDPCSPNSAASGKYGERPASVSTGDIHSLVIASDYRVPDPGRVWPLLQRNKSALADIGAHHVLIYASTHDSGRVLVMIGVRSREPIVELLRSRVFFDWFDAMGVDDIPAVFAGEIVDRFVAAPTTTQSTPRVPGVVVAAFASVNNVSNLTAEVRSAIARFTAAGIRKTWVFQAFDDAHEVLILQEFADEAGARQWIEHPDAAAEWMSGAGVGAYPPLFVGRFFDMMRIEALQ
Bibliography
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant