Gene Rv0869c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in molybdenum cofactor biosynthesis; involved in the biosynthesis of molybdopterin precursor Z from guanosine. |
| Product | Probable molybdenum cofactor biosynthesis protein A2 MoaA2 |
| Comments | Rv0869c, (MTV043.62c), len: 360 aa. Probable moaA2, molybdenum cofactor biosynthesis protein, highly similar to others e.g. CAB59437.1|AL132644|SCI8_6 molybdenum cofactor biosynthesis protein A from Streptomyces coelicolor (341 aa), FASTA scores: opt: 1336, E(): 0, (61.7% identity in 332 aa overlap); S57490|X78980|ANMOAA_1 molybdopterin cofactor synthesis protein from Arthrobacter nicotinovorans (fragment) (374 aa), FASTA scores: opt: 1059, E(): 0, (49.9% identity in 369 aa overlap); Q44118|MOAA_ARTNI probable molybdopterin cofactor synthesis protein A from Arthrobacter nicotinovorans plasmid pAO1 (355 aa); etc. Also similar to Rv3109|MTCY164.19|Z95150|MOAA1 putative molybdenum cofactor biosynthesis protein A from Mycobacterium tuberculosis (359 aa), FASTA scores: opt: 657, E(): 0, (36.6% identity in 309 aa overlap). Belongs to the MoaA / NifB / PqqE family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 966265 | 967347 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0869c|moaA2
MTLTALGMPALRSRTNGIADPRVVPTTGPLVDTFGRVANDLRVSLTDRCNLRCSYCMPERGLRWLPGEQLLRPDELARLIHIAVTRLGVTSVRFTGGEPLLAHHLDEVVAATARLRPRPEISLTTNGVGLARRAGALAEAGLDRVNVSLDSIDRAHFAAITRRDRLAHVLAGLAAAKAAGLTPVKVNAVLDPTTGREDVVDLLRFCLERGYQLRVIEQMPLDAGHSWRRNIALSADDVLAALRPHFRLRPDPAPRGSAPAELWLVDAGPNTPRGRFGVIASVSHAFCSTCDRTRLTADGQIRSCLFSTEETDLRRLLRGGADDDAIEAAWRAAMWSKPAGHGINAPDFIQPDRPMSAIGG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
