Gene Rv0887c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0887c, (MTCY31.15c), len: 152 aa. Conserved hypothetical protein, highly similar to others e.g. NP_436346.1|NC_003037 Hypothetical protein from Sinorhizobium meliloti (149 aa); AL132644|SCI8_26 hypothetical protein from Streptomyces coelicolor (194 aa), FASTA scores: opt: 220, E(): 1.5e-07, (33.6% identity in 131 aa overlap); etc. Also shows weak similarity with transposases and related proteins. |
| Functional category | Conserved hypotheticals |
| Proteomics | Translational start site supported by proteomics data (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 985513 | 985971 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0887c|Rv0887c
MAINVEPALSPHLVVDDAASAIDFYVKAFDAVELGRVPGPDGKLIHAALRINGFTVMLNDDVPQMCGGKSMTPTSLGGTPVTIHLTVTDVDAKFQRALNAGATVVTALEDQLWGDRYGVVADPFGHHWSLGQPVREVNMDEIQAAMSSQGDG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
