Gene Rv0895
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May be involved in synthesis of triacylglycerol |
| Product | Possible triacylglycerol synthase (diacylglycerol acyltransferase) |
| Comments | Rv0895, (MTCY31.23), len: 505 aa. Possible triacylglycerol synthase (See Daniel et al., 2004); member of family with: Rv3740c, Rv3734c, Rv1425, Rv1760, etc. Shows some similarity with NP_301898.1|NC_002677 conserved membrane protein from Mycobacterium leprae (491 aa). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 997782 | 999299 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0895|Rv0895
VRQQQEADVVALGRKPGLLCVPERFRAMDLPMAAADALFLWAETPTRPLHVGALAVLSQPDNGTGRYLRKVFSAAVARQQVAPWWRRRPHRSLTSLGQWSWRTETEVDLDYHVRLSALPPRAGTAELWALVSELHAGMLDRSRPLWQVDLIEGLPGGRCAVYVKVHHALADGVSVMRLLQRIVTADPHQRQMPTLWEVPAQASVAKHTAPRGSSRPLTLAKGVLGQARGVPGMVRVVADTTWRAAQCRSGPLTLAAPHTPLNEPIAGARSVAGCSFPIERLRQVAEHADATINDVVLAMCGGALRAYLISRGALPGAPLIAMVPVSLRDTAVIDVFGQGPGNKIGTLMCSLATHLASPVERLSAIRASMRDGKAAIAGRSRNQALAMSALGAAPLALAMALGRVPAPLRPPNVTISNVPGPQGALYWNGARLDALYLLSAPVDGAALNITCSGTNEQITFGLTGCRRAVPALSILTDQLAHELELLVGVSEAGPGTRLRRIAGRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Daniel J, Deb C, Dubey VS, Sirakova TD, Abomoelak B, Morbidoni HR and Kolattukudy PE [2004]. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. Function Product
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant