Gene Rv0917
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | High-affinity uptake of glycine betaine. Supposedly responsible for the translocation of the substrate across the membrane. |
| Product | Possible glycine betaine transport integral membrane protein BetP |
| Comments | Rv0917, (MTCY21C12.11), len: 593 aa. Possible betP, glycine betaine transporter, integral membrane protein, highly similar to many transporters, mainly glycine betaine transporters, e.g. P54582|BETP_CORGL glycine betaine transporter from Corynebacterium glutamicum (Brevibacterium flavum) (595 aa), FASTA scores: opt: 1367, E(): 0, (42.7% identity in 504 aa overlap); T35264 probable BccT family transporter from Streptomyces coelicolor (578 aa); NP_243511.1|NC_002570 glycine betaine transporter from Bacillus halodurans (504 aa); NP_439848.1|NC_000907 high-affinity choline transport protein (betT) from Haemophilus influenzae (669 aa); etc. Seems to belong to the BCCT (TC 2.33) family of transporters. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1022087 | 1023868 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0917|betP
MSAKERGDQNAVVDALRSIQPAVFIPASVVIVAMIVVSVVYSSVAENAFVRLNSAITGGVGWWYILVATGFVVFALYCGISRIGTIRLGRDDELPEFSFWAWLAMLFSAGMGIGLVFYGVAEPLSHYLRPPRSRGVPALTDAAANQAMALTVFHWGLHAWAIYVVVGLGMAYMTYRRGRPLSVRWLLEPVVGRGRVEGALGHAVDVIAIVGTLFGVATSLGFGITQIASGLEYLGWIRVDNWWMVGMIAAITATATASVVSGVSKGLKWLSNINMALAAALALFVLLLGPTLFLLQSWVQNLGGYVQSLPQFMLRTAPFSHDGWLGDWTIFYWGWWISWAPFVGMFIARISRGRTIREFIGAVLLVPTVIASLWFTIFGDSALLRQRNNGDMLVNGAVDTNTSLFRLLDGLPIGAITSVLAVLVIVFFFVTSSDSGSLVIDILSAGGELDPPKLTRVYWAVLEGVAAAVLLLIGGAGSLTALRTAAIATALPFSIVMVVACYAMTKAFHFDLAATPRLLHVTVPDVVAAGNRRRHDISATLSGLIAVRDVDSGTYIVHPDTGALTVTAPPDPLDDHVFESDRHVTRRNTTSSR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
