Gene Rv0919
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylation, substrate unknown |
| Product | GCN5-related N-acetyltransferase |
| Comments | Rv0919, (MTCY21C12.13), len: 166 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Some similarity to Q50115 hypothetical protein from Mycobacterium leprae (90 aa), FASTA scores: opt: 243, E(): 5.3e-11, (56.5% identity in 85 aa overlap). Alternative nucleotide at position 1025106 (T->C; F141F) has been observed. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1024684 | 1025184 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0919|Rv0919
VSGYSAPRRISDADDVTSFSSGEPSLDDYLRKRALANHVQGGSRCFVTCRDGRVVGFYALASGSVAHADAPGRVRRNMPDPVPVILLSRLAVDRKEQGRGLGSHLLRDAIGRCVQAADSIGLRAILVHALHDEARAFYVHFDFEISPTDPLHLMLLMKDARALIGD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant