Gene Rv0926c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0926c, (MTCY21C12.20c), len: 358 aa. Conserved hypothetical protein, similar to Rv1059 conserved hypothetical protein from Mycobacterium tuberculosis (354 aa). Also shows some similarity to AF170923|AF170923_3 dihydrodipicolinate reductase from Mastigocladus laminosus (278 aa), FASTA scores: opt: 170, E(): 0.00088, (25.7% identity in 276 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1032710 | 1033786 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0926c|Rv0926c
MAIPVVQLGTGNVGVHSLRALIADPEFELTGVWVSSDAKAGKDAAELAGLADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINIVGSGPVFLQYPWQVIPDEIIKPLQDAARAGNSSLYVNGIDPGFANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMFDVMGFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPEAFNIASGHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPCYAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLITGEGRYAAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
